PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_6859C24E5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 479aa    MW: 50918 Da    PI: 6.1711
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_6859C24E5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.1e-38102161261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt+GG++rn+PvG+grrk+k+s
  Traes_2BS_6859C24E5.1 102 PDKILPCPRCNSMDTKFCYYNNYNIHQPRHFCRGCQRYWTAGGSMRNLPVGAGRRKSKSS 161
                            7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3099159IPR003851Zinc finger, Dof-type
PfamPF027012.7E-31104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.127106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MELAGAAHPQ PPESDVAPPR TPPQAPAEDS CKDTGDTRIT EENSCTPPDL NLSQPNNSGL  60
NSSSACENQT SNSDEMTEPE STLEAAKTKG DGSNKEKVLK KPDKILPCPR CNSMDTKFCY  120
YNNYNIHQPR HFCRGCQRYW TAGGSMRNLP VGAGRRKSKS SGTNCNGILI PGSSLAAPGG  180
DASVIPLPIK ENQPAVLFGS DATLPNSMAS LLRVEEQNKN SNPASTAHPR NGENQTCPPS  240
AATSDNPRIE SVKVAVGVHQ NGITGDCNGV TPMPPIPCFP GPPFMYPWNP AWNGVPAMAA  300
PVCPVPAEPA NCSENGHGGN IQWNFPSMVP MPGFCGPPIP FPLMPPSVWP LVSPWPNGAW  360
SAPWLGPGYS MSAAPPTSSS TCSDSGSPVL GKHPRDSDPQ GGEKAEKSLW IPKTLRIDDP  420
DEAAKSSIWT TLGIEPGERG MFRPFQPKSG GREQMSNAAR VMQANPAAQS RFASFQEMT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3588050.0AK358805.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1083I10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233788.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLW5BKT60.0W5BKT6_WHEAT; Uncharacterized protein
STRINGMLOC_19593.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-42cycling DOF factor 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]